PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_001409-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 274aa    MW: 31296.4 Da    PI: 7.7373
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_001409-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.7e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l++++++ G ++W++ ++  g+ R++k+c++rw +yl
  AHYPO_001409-RA 14 KGPWTPEEDQILINYIRLNGHNNWRALPKLAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding54.23.3e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T++E+e +++++++lG++ W++Ia++++ gRt++++k+ w+++l
  AHYPO_001409-RA  67 RGNFTQDEEETIIKLHEMLGNR-WSAIAARLP-GRTDNEIKNVWHTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-24564IPR009057Homeodomain-like
PROSITE profilePS5129418.004961IPR017930Myb domain
SuperFamilySSF466895.5E-3010108IPR009057Homeodomain-like
SMARTSM007171.6E-141363IPR001005SANT/Myb domain
PfamPF002491.0E-151461IPR001005SANT/Myb domain
CDDcd001677.04E-111661No hitNo description
PROSITE profilePS5129425.84862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.2E-2765117IPR009057Homeodomain-like
SMARTSM007174.6E-1566114IPR001005SANT/Myb domain
PfamPF002496.9E-1667112IPR001005SANT/Myb domain
CDDcd001672.40E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MGRAPCCEKM GLKKGPWTPE EDQILINYIR LNGHNNWRAL PKLAGLLRCG KSCRLRWTNY  60
LRPDIKRGNF TQDEEETIIK LHEMLGNRWS AIAARLPGRT DNEIKNVWHT HLKKRLVKQT  120
EPDQIVSTTT TRTTKKRSRK PKSKEKNMVS KVIKCEPVSP QPCTSTSSII TSSSSGNNAN  180
FNKENVVLSN GYIGDFPELN DEFWMEVLSV EDTAMSTDDN LPSVSHCNFD TSENLIVKSE  240
SESGSKFHCD EMDFFWYNLL TRNDDLPEFS EMM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-27121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010679296.11e-133PREDICTED: myb-related protein Myb4
TrEMBLA0A0J8CD611e-133A0A0J8CD61_BETVU; Uncharacterized protein
STRINGPOPTR_0002s03960.17e-88(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.14e-78myb domain protein 14